PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_25708.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 213aa    MW: 24072.7 Da    PI: 9.3912
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_25708.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1631.1e-50111431128
           NAM   1 lppGfrFhPtdeelvveyLkkkvegkk....lelee.....vikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                   lppGfrFhP+d+elv +yL +k+ g          +     ++ +vd++k+ePwdLp+ +  + kewyf+s rdkkyatg+r+nrat+sgyWkatgk
  MLOC_25708.1  11 LPPGFRFHPRDDELVLDYLSRKLGGGAgpavA---SiygcpAMVDVDLNKTEPWDLPEIACIGGKEWYFYSLRDKKYATGQRTNRATESGYWKATGK 104
                   79***********************9965541...14555479**************7666789********************************* PP

           NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                   d+ + + kg lvg++ktLvfy+grapkg+kt+Wvmhe+r 
  MLOC_25708.1 105 DRLISR-KGLLVGMRKTLVFYEGRAPKGKKTEWVMHEFRK 143
                   ****99.999****************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.37E-602166IPR003441NAC domain
PROSITE profilePS5100554.75911166IPR003441NAC domain
PfamPF023659.6E-2612142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MSSLSMVEAR LPPGFRFHPR DDELVLDYLS RKLGGGAGPA VASIYGCPAM VDVDLNKTEP  60
WDLPEIACIG GKEWYFYSLR DKKYATGQRT NRATESGYWK ATGKDRLISR KGLLVGMRKT  120
LVFYEGRAPK GKKTEWVMHE FRKEGQGDHM KLPLKEDWVL CRVFYKTRTT IAKPPTGSSY  180
KIDSAVATSL PPLIDNYIAF DHPGMLQNLE GYE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-49716611168Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3653980.0AK365398.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv2033O22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003563412.11e-140PREDICTED: NAC domain-containing protein 21/22-like
SwissprotQ84TE63e-85NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLF2DGS71e-158F2DGS7_HORVD; Predicted protein (Fragment)
TrEMBLF2DND01e-158F2DND0_HORVD; Predicted protein (Fragment)
TrEMBLM0VF641e-159M0VF64_HORVD; Uncharacterized protein
STRINGMLOC_53744.11e-140(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56010.22e-86NAC domain containing protein 1